DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-1

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_496039.1 Gene:gcy-1 / 191639 WormBaseID:WBGene00001528 Length:1137 Species:Caenorhabditis elegans


Alignment Length:297 Identity:92/297 - (30%)
Similarity:144/297 - (48%) Gaps:42/297 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  1347 YGNAVANQDKVRVQNM---KNQADMLLHNIIPKHVAEHLK--NTAKYSENHHNIAIIFASIVNFN 1406
            |.:.:..:.:.|.:.:   |.:||:||..::||.|||.||  .|.: .|...::.:.|:.:|.| 
 Worm   845 YTSTLEEEIEERTKELTLEKKKADILLSRMLPKQVAERLKAGQTVE-PEGFDSVTVFFSDVVKF- 907

  Fly  1407 EMYDESYLGGK----EFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGD 1467
                 :.|..|    :.:.:||:|..:||.::   |...|.|:::||..::..||| |:..|.. 
 Worm   908 -----TILASKCSPFQTVNLLNDLYSNFDTII---EQHGVYKVESIGDGYLCVSGL-PTRNGYA- 962

  Fly  1468 EHIHTLMEFSIAMQEVVDAFN-KDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASR 1531
             ||..:::.|:...|...:|| ..|...|:.||||:|.|...|||:|.|...|.::||.||.|||
 Worm   963 -HIKQIVDMSLKFMEYCKSFNIPHLPRENVELRIGVNSGPCVAGVVGLSMPRYCLFGDTVNTASR 1026

  Fly  1532 MDSTGLPNRIQVGKDCLPFLT----NRYEFEPRGSVYVKGKDHMEVFLYTTRRDNPLDDDEADKV 1592
            |:|.|.|:.|.:..|....||    |:||...||.|.:|||..||.| :...|...::..|...:
 Worm  1027 MESNGKPSLIHLTNDAHSLLTTHYPNQYETSSRGEVIIKGKGVMETF-WVHGRFGEMEPTELRSI 1090

  Fly  1593 EQLGTKKM-----------EHEGRDE---DVVQGEQQ 1615
            ....|..:           .|..|..   |.:||.|:
 Worm  1091 SNRSTPPVTNDRWIPNPSSSHGSRPSSVYDPLQGHQK 1127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485
Guanylate_cyc 361..535 CDD:278633
CYCc 1362..1556 CDD:214485 70/207 (34%)
Guanylate_cyc 1388..1575 CDD:278633 67/195 (34%)
gcy-1NP_496039.1 PBP1_NPR_GC_like 35..449 CDD:107347
ANF_receptor 53..432 CDD:279440
PKc_like 555..821 CDD:304357
HNOBA <840..883 CDD:285003 12/37 (32%)
CYCc 862..1051 CDD:214485 69/201 (34%)
Guanylate_cyc 889..1077 CDD:278633 68/201 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.