DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-11

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001359843.1 Gene:gcy-11 / 181745 WormBaseID:WBGene00001537 Length:1168 Species:Caenorhabditis elegans


Alignment Length:286 Identity:88/286 - (30%)
Similarity:146/286 - (51%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 DPSNRILILRI---MAHLSVHLVG-VHVLIMNLV-RMRGTFMKVGQNLLVRR--QLEMEKQLKEK 309
            ||::|..|.::   :..||..|.| :...||||: |.|...    ::::..|  |||.|::..|.
 Worm   870 DPASRPSIKKVRELLKPLSKGLKGNIADNIMNLLDRYRNNL----EDVIKERTEQLEDERKRNES 930

  Fly   310 MIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADI 374
            ::..::|..||:.|.|          |.|.::.:                    .::|||.|:||
 Worm   931 LLLQLLPKSVANSLKN----------GQPVDAEF--------------------YDSVSIYFSDI 965

  Fly   375 VGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVE 438
            ||||.:||..|..|:|.:||:|:..||.:.....|.|:.|:||.|..|||.||..:. ||.....
 Worm   966 VGFTALSSKSTPLQVVNMLNNLYTNFDTIIDKFDCYKVETIGDAYMFVSGLPEVNSYLHAGEVAS 1030

  Fly   439 MGLGMIDAMRCFDAQR--HEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPE 501
            ..|.::|:::.|....  .|.:::|:|.|||.|:.|:||.|..::.::.:.|.:||.|||||:|.
 Worm  1031 ASLELLDSIKTFTVSHCPDEKLRLRIGNHTGPVVTGVVGIRMPRYCLFGDTVIIANMMESSGEPM 1095

  Fly   502 QVHISQETSSFL--GDAYYLEEGEEV 525
            ::.||.:....:  ...|..|:.|::
 Worm  1096 RIQISSDAYELILKCGGYVTEQREKI 1121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 67/220 (30%)
Guanylate_cyc 361..535 CDD:278633 61/170 (36%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-11NP_001359843.1 Periplasmic_Binding_Protein_type1 <234..452 CDD:385651
PKc_like 640..890 CDD:389743 6/19 (32%)
CYCc 923..1116 CDD:214485 68/222 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.