DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and daf-11

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_505960.3 Gene:daf-11 / 179605 WormBaseID:WBGene00000907 Length:1077 Species:Caenorhabditis elegans


Alignment Length:277 Identity:76/277 - (27%)
Similarity:128/277 - (46%) Gaps:56/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 VHVLIMNLVRMRGTFMKVGQNLLVRR---QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDA 334
            |.::|.||     |....|.|..|:.   :||.|::..::::..::|..||:.|.|     |:  
 Worm   702 VDLMIKNL-----TAYTQGLNETVKNRTAELEKEQEKGDQLLMELLPKSVANDLKN-----GI-- 754

  Fly   335 GGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFER 399
             .:.|:.:                      ||.:||::||||||.:.|.....::|.:|:.:::|
 Worm   755 -AVDPKVY----------------------ENATILYSDIVGFTSLCSQSQPMEVVTLLSGMYQR 796

  Fly   400 FDDLCSLSGCEKISTLGDCYYCVSGCP-EPRADH--AICCVEMGLGMIDAMRCFDAQRHEG--VK 459
            ||.:.|..|..|:.|:||.|...:|.| ....||  :||.:  .|...|.:..|:.....|  :.
 Worm   797 FDLIISQQGGYKMETIGDAYCVAAGLPVVMEKDHVKSICMI--ALLQRDCLHHFEIPHRPGTFLN 859

  Fly   460 MRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGEE 524
            .|.|.::|.|..|::|.:..::..:...|.||:||||||..:::.::      |.....|||...
 Worm   860 CRWGFNSGPVFAGVIGQKAPRYACFGEAVILASKMESSGVEDRIQMT------LASQQLLEENFP 918

  Fly   525 VF-----GHRTYFVVGR 536
            .|     |.||...:||
 Worm   919 QFVCSNRGGRTIEGIGR 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 57/220 (26%)
Guanylate_cyc 361..535 CDD:278633 56/183 (31%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
daf-11NP_505960.3 Periplasmic_Binding_Protein_Type_1 <33..295 CDD:299141
PKc_like 447..695 CDD:304357
HNOBA <714..750 CDD:285003 9/35 (26%)
CYCc 729..922 CDD:214485 61/230 (27%)
Guanylate_cyc 756..943 CDD:278633 59/210 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.