DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-29

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001364597.1 Gene:gcy-29 / 175116 WormBaseID:WBGene00007314 Length:1069 Species:Caenorhabditis elegans


Alignment Length:306 Identity:82/306 - (26%)
Similarity:139/306 - (45%) Gaps:53/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 PSNRILILRIMAHLSVHLVGVHVLIMNLVRMRGTFMK-----VGQNLLVRRQLEMEKQLK-EKMI 311
            |..|..|.|:.....:.|.....|:.:::||...:..     ||:    |.:|..|..|: |:::
 Worm   789 PDMRPTIRRVRLATEIALKTKGNLVDSMMRMMEEYANNLEKLVGE----RTKLAEEANLRAERLL 849

  Fly   312 HSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVG 376
            ..::|..||         ..|.||.......|                     ::.:::|:||||
 Worm   850 FQLLPKHVA---------IELKAGRTVAPKMY---------------------DSATVMFSDIVG 884

  Fly   377 FTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCP-EPRADHAICCVEMG 440
            ||::.|..|..::|.:||.|:..||.:.|...|.|:.|:||.|..|||.| |....|......:.
 Worm   885 FTKLCSASTPIEVVNLLNKLYSEFDTVISKHDCYKVETIGDAYMVVSGIPIENGQRHVANISAVT 949

  Fly   441 LGMIDAMRCFDA--QRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQV 503
            ||::|.::.|:.  :|...:.:|:|..:|.|...:||....::.::...|::|..|||||:..:|
 Worm   950 LGIMDLLKVFEVPHRRDYRLTIRLGFASGQVSAAVVGLSSPRYCLFGETVNIAAVMESSGEGGRV 1014

  Fly   504 HISQETSSFLGDAYYLEEGEEVFGHR---------TYFVVGRRRDF 540
            .|: |||..|.:..|.|...|:.|..         ||::.|:..|:
 Worm  1015 QIT-ETSKILLENEYPEFIIEIRGINKDVKQDDFVTYWLTGKDEDY 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 62/219 (28%)
Guanylate_cyc 361..535 CDD:278633 58/185 (31%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-29NP_001364597.1 PBP1_NPR_GC-like 27..403 CDD:380575
PKc_like 534..804 CDD:419665 4/14 (29%)
CYCc 840..1033 CDD:214485 64/223 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.