DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gcy-28

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001021600.1 Gene:gcy-28 / 172051 WormBaseID:WBGene00020131 Length:1276 Species:Caenorhabditis elegans


Alignment Length:271 Identity:85/271 - (31%)
Similarity:142/271 - (52%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LIMNLVRMRGTFMKVGQNLLVRRQLE--MEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLP 338
            |:.||::....:....:.|:..|..|  .||:..|:::|.::||.:||.|:         ||   
 Worm  1022 LVDNLLKRMEQYANNLEGLVEERTQEYLAEKKKVEELLHQLLPPAIADTLI---------AG--- 1074

  Fly   339 PESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDL 403
                              |.....|.:.|:|.|:||||||.:||..|..|:|.:||||:..||.:
 Worm  1075 ------------------RAVQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGV 1121

  Fly   404 CSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQR--HEGVKMRVGVHT 466
            .......|:.|:||.|..|||.||.|.|||....:|.|.::..::.|..:.  ||.:|:|:|:|:
 Worm  1122 VDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHS 1186

  Fly   467 GTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFL----GDAYYLEEGEEVFG 527
            |:|:.|:||::..::.::.:.|:.:::|||:|.|.::|:||:|...|    |....|....|:.|
 Worm  1187 GSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKG 1251

  Fly   528 ---HRTYFVVG 535
               ..||::.|
 Worm  1252 KGMQTTYWLRG 1262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 73/221 (33%)
Guanylate_cyc 361..535 CDD:278633 66/182 (36%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gcy-28NP_001021600.1 PBP1_NPR_like 42..486 CDD:107368
ANF_receptor 64..465 CDD:279440
PK_GC-A_B 722..1016 CDD:270944
STYKc 741..1008 CDD:214568
HNOBA <1026..1071 CDD:285003 12/44 (27%)
CYCc 1050..1233 CDD:214485 71/212 (33%)
Guanylate_cyc 1077..1262 CDD:278633 66/184 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.