DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gucy2e

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_036012232.1 Gene:Gucy2e / 14919 MGIID:105123 Length:1139 Species:Mus musculus


Alignment Length:329 Identity:91/329 - (27%)
Similarity:151/329 - (45%) Gaps:75/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LIMNLVRMRGTFMKVGQNLLVRR--QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLP 338
            :|.:::||...:....::|:..|  :||.|||..::::..::||.||:.|          ..|..
Mouse   850 IIDSMLRMLEQYSSNLEDLIRERTEELEQEKQKTDRLLTQMLPPSVAEAL----------KMGTS 904

  Fly   339 PESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDL 403
            .|..|                    .|.|::.|:||||||.:|:.....::|::||||:..||.:
Mouse   905 VEPEY--------------------FEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAI 949

  Fly   404 CSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRH---EGVKMRVGV 464
            .......|:.|:||.|...||.|:.... ||.....|.|.::.|:..| ..||   ..|::|:|:
Mouse   950 IGAHDVYKVETIGDAYMVASGLPQRNGQRHAAEIANMSLDILSAVGSF-RMRHMPEVPVRIRIGL 1013

  Fly   465 HTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEG------- 522
            |:|..:.|:||....::.::.:.|:.|::|||:|.|.::|::..|...|   ..|::|       
Mouse  1014 HSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNMSTVRIL---RALDQGFQMECRG 1075

  Fly   523 -EEVFG---HRTYFVVGRRRDFTRTNSLSPSMPANATGSSLLLPGA--HGASLSQSATNVSAVQP 581
             .|:.|   ..||::|||    ...|...|..|.       |.|||  ||.||.:          
Mouse  1076 RTELKGKGIEDTYWLVGR----LGFNKPIPKPPD-------LQPGASNHGISLQE---------- 1119

  Fly   582 NVPP 585
             :||
Mouse  1120 -IPP 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 62/219 (28%)
Guanylate_cyc 361..535 CDD:278633 57/188 (30%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gucy2eXP_036012232.1 PBP1_sensory_GC_DEF-like 58..465 CDD:380594
PK_GC-2D 570..845 CDD:270945
HNOBA <854..899 CDD:400168 13/44 (30%)
CYCc 879..1070 CDD:214485 64/224 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.