DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gucy2f

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_571939.2 Gene:gucy2f / 140424 ZFINID:ZDB-GENE-011128-7 Length:1107 Species:Danio rerio


Alignment Length:283 Identity:80/283 - (28%)
Similarity:143/283 - (50%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LIMNLVRMRGTFMKVGQNLLVRR--QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLP 338
            :|.:::||...:....::|:..|  :||:|||..||::..::||.||:.|..          |..
Zfish   821 IIDSMLRMLEQYSSNLEDLIRERTEELEVEKQRTEKLLSEMLPPSVAEALKT----------GAS 875

  Fly   339 PESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDL 403
            .|..|                    .:.|:|.|:||||||.:||.....::|::||||:..||.:
Zfish   876 VEPEY--------------------FDQVTIYFSDIVGFTTISSLSDPIEVVDLLNDLYSLFDAV 920

  Fly   404 CSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRH---EGVKMRVGV 464
            .......|:.|:||.|...||.|:...: ||.....|.|.::.::..| ..||   ..|::|:|:
Zfish   921 LGSHDVYKVETIGDAYMVASGLPKKNGNKHAAEIANMSLNILSSVGSF-KMRHMPEVPVRIRIGI 984

  Fly   465 HTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSF---LGDAYYLE------ 520
            |:|..:.|:||....::.::.:.|:.|::|||:|.|.::|::..|...   |.|.|.::      
Zfish   985 HSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNISTVQILRSLNDGYKIDVRGKTE 1049

  Fly   521 -EGEEVFGHRTYFVVGRRRDFTR 542
             :|:.:  ..||::|| :.:||:
Zfish  1050 LKGKGI--EETYWLVG-KANFTK 1069

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 65/222 (29%)
Guanylate_cyc 361..535 CDD:278633 56/187 (30%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gucy2fNP_571939.2 PBP1_sensory_GC_DEF_like 59..440 CDD:107366
PK_GC-2D 551..816 CDD:270945
HNOBA <825..870 CDD:311573 15/44 (34%)
CYCc 850..1042 CDD:214485 66/222 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.