DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Npr2

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_446290.1 Gene:Npr2 / 116564 RGDID:620851 Length:1047 Species:Rattus norvegicus


Alignment Length:282 Identity:83/282 - (29%)
Similarity:143/282 - (50%) Gaps:49/282 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 GVHVLIMNLVRMRGTFMKVGQNL--LVRRQLEM---EKQLKEKMIHSVMPPKVADMLLNEGGPSG 331
            |..:|...|:||.    :...||  ||..:.:.   ||:..|.:::.::|..||:.|        
  Rat   794 GTSILDNLLLRME----QYANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQL-------- 846

  Fly   332 LDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDL 396
                           :....|::       .:.::|:|.|:||||||.:|:..|..|:|.:||||
  Rat   847 ---------------KRGETVQA-------EAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDL 889

  Fly   397 FERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQR--HEGV 458
            :..||.:.......|:.|:||.|..|||.|..... ||.....|.|.::||:..|..:.  |:.:
  Rat   890 YTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQL 954

  Fly   459 KMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGD--AYYLE- 520
            ::|:|||||.|..|:||.:..::.::.:.|:.|::|||:|:..::|:|..|...|.:  .:.|| 
  Rat   955 RLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLEL 1019

  Fly   521 EGE-EVFGH---RTYFVVGRRR 538
            .|: |:.|.   |||:::|.|:
  Rat  1020 RGDVEMKGKGKMRTYWLLGERK 1041

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 64/223 (29%)
Guanylate_cyc 361..535 CDD:278633 64/183 (35%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Npr2NP_446290.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 518..792 CDD:270944
HNOBA <798..846 CDD:400168 14/51 (27%)
CYCc 825..1009 CDD:214485 63/213 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.