DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and Gucy2e

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_570093.2 Gene:Gucy2e / 113911 RGDID:69322 Length:1123 Species:Rattus norvegicus


Alignment Length:293 Identity:78/293 - (26%)
Similarity:134/293 - (45%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 NLVRMRGTFMKVGQNLLVRR--QLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPES 341
            :::||...:.:..:.|:..|  :||:|::..|:::..::||.||..|          ..|...|.
  Rat   832 SMLRMLEKYSQSLEGLVQERTEELELERRKTERLLSQMLPPSVAHAL----------KMGTTVEP 886

  Fly   342 HYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSL 406
            .|                    .:.|:|.|:||||||.:|:.....::|..||||:..||.:...
  Rat   887 EY--------------------FDQVTIYFSDIVGFTTISALSEPIEVVGFLNDLYTMFDAVLDS 931

  Fly   407 SGCEKISTLGDCYYCVSGCPEPRAD-HAICCVEMGLGMIDAMRCFDAQRHE---GVKMRVGVHTG 467
            ....|:.|:||.|...||.|....: ||.....|.|.::.....| ..||.   .:::|.|:|:|
  Rat   932 HDVYKVETIGDAYMVASGLPRRNGNRHAAEIANMALEILSYAGNF-RMRHAPDVPIRVRAGLHSG 995

  Fly   468 TVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEG--------EE 524
            ..:.|:||....::.::.:.|:.|::|||:|.|.::|:|:.|...|   ..|:||        .|
  Rat   996 PCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSRNTVQAL---LSLDEGYKIDVRGQTE 1057

  Fly   525 VFG---HRTYFVVGRR---RDFTRTNSLSPSMP 551
            :.|   ..||::.|:.   |......|:.|..|
  Rat  1058 LKGKGLEETYWLTGKTGFCRSLPTPLSIQPGDP 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 60/219 (27%)
Guanylate_cyc 361..535 CDD:278633 57/188 (30%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
Gucy2eNP_570093.2 PBP1_sensory_GC_DEF-like 71..445 CDD:380594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 529..556
PK_GC-2D 554..824 CDD:270945
CYCc 861..1050 CDD:214485 62/222 (28%)
Interaction with NCALD. /evidence=ECO:0000269|PubMed:18178149 880..921 16/60 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.