DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gucy1b1

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:446 Identity:105/446 - (23%)
Similarity:171/446 - (38%) Gaps:156/446 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 DLYREHRTVTSAVTALLLCGA--------SLAFLTYTGRAFSPLGHFAICLEIVLLIYTALPMPL 203
            |.:.|:.|..|.::....|.|        ...|:|..|.|                ||..||. |
 Frog   196 DRFEENGTQESRISPYTFCKAFPFHIMFDRDLFVTQCGNA----------------IYRVLPQ-L 243

  Fly   204 WLGASTAISYSIAFEMV-SHMVIGCSAIHGGPMHGGGGAAGGSGMEANGDPSNRILILRIMAHL- 266
            ..|....:|   .|.:| .|:.|   :.||...|                 .|.:.:||....| 
 Frog   244 QPGNCNLLS---VFSLVRPHIDI---SFHGILSH-----------------INTVFVLRSKEGLL 285

  Fly   267 -------SVHLVGVHV------------------------LIMNL--VRMRGTFM---------- 288
                   ...|.|..:                        .:|||  :..||.::          
 Frog   286 DVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATR 350

  Fly   289 -------------KVGQNLLV--------RRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGL 332
                         |:.|.|.:        .|.||.||:..:.:::||:||.||:.|.::      
 Frog   351 DLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLLYSVLPPSVANELRHK------ 409

  Fly   333 DAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGF----TRMSSTKTAEQLVEIL 393
                                    ||......:||:|||:.||||    ::.:|.:.|.::|.:|
 Frog   410 ------------------------RPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLL 450

  Fly   394 NDLFERFDDLCSLSG---CEKISTLGDCYYCVSGCPEPRADHA--ICCVEMGLGMIDAMRCFDAQ 453
            ||::.|||.|.....   ..|:.|:||.|..|||.|||...||  ||.:.:.:..|......|. 
 Frog   451 NDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVDG- 514

  Fly   454 RHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQET 509
              |.|::.:|:|||.|:.|::|.|..::.::.|.|:|.::.|::|:..::::|:.|
 Frog   515 --ESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 64/217 (29%)
Guanylate_cyc 361..535 CDD:278633 53/158 (34%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 45/238 (19%)
Guanylate_cyc 412..605 CDD:306677 53/160 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.