DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac13E and gucy1b1

DIOPT Version :9

Sequence 1:NP_001259575.1 Gene:Ac13E / 32485 FlyBaseID:FBgn0022710 Length:1703 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:219 Identity:64/219 - (29%)
Similarity:114/219 - (52%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 RQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMH 362
            |.||.||:..:::::||:||.||:.|.::                              ||....
Zfish   381 RALEDEKKKTDRLLYSVLPPSVANELRHK------------------------------RPVPAK 415

  Fly   363 SMENVSILFADIVGF----TRMSSTKTAEQLVEILNDLFERFDDLCSLSG---CEKISTLGDCYY 420
            ..:||:|||:.||||    ::.:|.:.|.::|.:|||::.|||.|.....   ..|:.|:||.|.
Zfish   416 RYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYM 480

  Fly   421 CVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWS 485
            .|||.|||...||.....:.|.|::........ .:.|::.:|:|||.|:.|::|.|..::.::.
Zfish   481 TVSGLPEPCTHHAKSICHLALDMMEIAGQVKVD-EDPVQITIGIHTGEVVTGVIGQRMPRYCLFG 544

  Fly   486 NDVSLANKMESSGKPEQVHISQET 509
            |.|:|.::.|::|:..::::|:.|
Zfish   545 NTVNLTSRTETTGEKGKINVSEYT 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac13ENP_001259575.1 CYCc 302..518 CDD:214485 61/215 (28%)
Guanylate_cyc 361..535 CDD:278633 50/156 (32%)
CYCc 1362..1556 CDD:214485
Guanylate_cyc 1388..1575 CDD:278633
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002
HNOBA 207..406 CDD:285003 11/24 (46%)
CYCc 385..584 CDD:214485 61/215 (28%)
Guanylate_cyc 412..605 CDD:278633 50/158 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.