DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6324 and Ogfr

DIOPT Version :9

Sequence 1:NP_001285273.1 Gene:CG6324 / 32481 FlyBaseID:FBgn0030647 Length:923 Species:Drosophila melanogaster
Sequence 2:NP_113550.3 Gene:Ogfr / 72075 MGIID:1919325 Length:633 Species:Mus musculus


Alignment Length:394 Identity:82/394 - (20%)
Similarity:140/394 - (35%) Gaps:123/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GKSQKVMEQQPSKI-KPM-------KPSEPMNPIQPVNLKGQINPIGPVNPMDQKIIKDSVNPMG 111
            |...|:...:|..| :|:       |...|.:|.|....:|:....|          :|.....|
Mouse   277 GPRDKLRRFRPQTISRPLMGLGQADKDEGPGDPSQEAGTQGRTCGSG----------RDLSGDSG 331

  Fly   112 QIKPMNPMCQRNSMASVNPY-------GQIHPKGPVNPNPNGQMKHMGPMNLMEPGNPNGQINSM 169
            ..:.:       |:.|..|.       .|.|.....:|..:.:.|..|......||.|:.|  .:
Mouse   332 TAEDL-------SLLSAKPQDVGTLDGDQRHEAKSPSPKESKKRKLEGNRQEQVPGEPDPQ--GV 387

  Fly   170 SQMNPMGQINIMSQMNLMDQINLMSQMNLMGEPVNPNVQMKPMETFPNGQINPMEPMNP------ 228
            |::..:.                   :||.|..::|..|            .|.|...|      
Mouse   388 SEVEKIA-------------------LNLEGCALSPTSQ------------EPREAEQPCLVARV 421

  Fly   229 ---------------------NGQMNSMSSMNPMGQMNPMDQMNLISQMNLMGGPVNPNGQMNPM 272
                                 |.|:.: |:::|.....|..|.:       ..||.:|..|:.|.
Mouse   422 ANEVRKRRKVEEGAEGDGVASNTQVQA-SALSPTPSECPESQKD-------GNGPEDPKSQVGPE 478

  Fly   273 EPGNPNGQINSMSQI---NPMGQINRPVNPNGQMNRMEPGNPNGQMNSMSQMNLMRGPVNPNGQM 334
            :|.:..|..:..||:   :|..|:. |.:|.||   :||.:|.||:          ||.:|.||:
Mouse   479 DPKSQVGPEDPKSQVGPEDPKSQVG-PEDPKGQ---VEPEDPKGQV----------GPEDPKGQV 529

  Fly   335 N-MNSYGQMNPMEPRNPNGQMNAMSQMNLMRGPVNPNGQMN-MNSYGQMNPMEPRNPNGQMNAMS 397
            . .:..||:.|.:|::..|..:..||:.    |.:|..|:. .:...|:.|.:|::..|..:..|
Mouse   530 GPEDPKGQVGPEDPKSQVGPEDPKSQVE----PEDPKSQVEPEDPKSQVEPEDPKSQVGPEDPQS 590

  Fly   398 QMNP 401
            |:.|
Mouse   591 QVGP 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6324NP_001285273.1 Med15 115..>449 CDD:255446 69/326 (21%)
OgfrNP_113550.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
OGFr_N 76..283 CDD:282512 2/5 (40%)
Bipartite nuclear localization signal. /evidence=ECO:0000255 257..286 2/8 (25%)
PHA03169 284..>548 CDD:223003 67/335 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..390 24/121 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 404..633 53/229 (23%)
14 X approximate tandem repeats 467..592 40/142 (28%)
VCX_VCY 472..620 CDD:291884 39/141 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.