DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC105948379

DIOPT Version :9

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_031748621.1 Gene:LOC105948379 / 105948379 -ID:- Length:241 Species:Xenopus tropicalis


Alignment Length:245 Identity:95/245 - (38%)
Similarity:140/245 - (57%) Gaps:23/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 SSIQFVYPKSNQPKSTKMENSEIKNKKREAAKKKPVRAIQASHDDYLN----KTMNLVDPEWELV 118
            ||.|...|.|  |..:.:.:| .:|...:|.:|:.| |.|...|..:.    :.:::|||.||::
 Frog    11 SSEQISTPYS--PDFSSVHHS-TENVTSQAREKRSV-ACQTDGDPAVTQPAIEQLSVVDPYWEVL 71

  Fly   119 DPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGICYQRGNRFVKQVTIRLSEPLLKLRPR 183
            ||.|||:.:|..|:::||:..|..:.|:||.::...||||.|  :....:..|||::|||:||||
 Frog    72 DPKPDIHVLFDDFNKRFFRGLLPPIDLKWSNRLCITAGICIQ--DNISGKCRIRLNKPLLELRPR 134

  Fly   184 KDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIW 248
            |:.||||||||||.|..|....:.:  ||..|...||.||:.:|.||||||.|..|..|.:.|.|
 Frog   135 KNTVETLLHEMIHYYQRVRGTSDID--HGATFHFHMERINRESGANITVYHDFDREYESLKRHWW 197

  Fly   249 RCTGICRERSPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEPPK 298
            :|.|.|.:      .|:|.::|.|..     |.|:|:|.|.|:|:.||.:
 Frog   198 KCNGPCAQ------VVRRLADRTPSS-----KAHKRKCGGEFIKVREPKR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 70/169 (41%)
ZnF_Rad18 582..605 CDD:128973
LOC105948379XP_031748621.1 SprT-like 77..183 CDD:402053 49/109 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1171375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.