DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC100490068

DIOPT Version :9

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_002932491.3 Gene:LOC100490068 / 100490068 -ID:- Length:194 Species:Xenopus tropicalis


Alignment Length:244 Identity:73/244 - (29%)
Similarity:110/244 - (45%) Gaps:65/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SELDSSIQFVYPKSNQPKSTKMENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELV 118
            |..|||.:: |...|.|      :....|:..|....:...::....|....|.:::|||.||::
 Frog     6 STSDSSSEY-YSTPNSP------DLSFNNQSNENFTSQEKHSVACQTDLSFQKDLSIVDPYWEVL 63

  Fly   119 DPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGIC-YQRGNRFVKQVTIRLSEPLLKLRP 182
            ||.|||:.:|..|:.|||..:|..:.|:||.::.|.||:| |.......|   :||::|||:||.
 Frog    64 DPKPDIHVLFEEFNAKFFGGQLPPIDLKWSNRLSSTAGLCIYNTRTGICK---LRLNKPLLELRA 125

  Fly   183 RKDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHI 247
            |||.|:                                           :||.|:.|..|.:.|.
 Frog   126 RKDTVQ-------------------------------------------IYHDFNQEYESLKRHW 147

  Fly   248 WRCTGICRERSPFWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEP 296
            |:|.|.|:|      .|||.::|.||.     |.|:|:|.|.|:|:.||
 Frog   148 WKCNGPCQE------VVKRLTDRTPGT-----KAHKRKCGGDFIKIQEP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 51/170 (30%)
ZnF_Rad18 582..605 CDD:128973
LOC100490068XP_002932491.3 SprT-like 69..>132 CDD:402053 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1171375at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.