DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mh and LOC100485137

DIOPT Version :9

Sequence 1:NP_573032.1 Gene:mh / 32480 FlyBaseID:FBgn0267977 Length:724 Species:Drosophila melanogaster
Sequence 2:XP_031750737.1 Gene:LOC100485137 / 100485137 -ID:- Length:236 Species:Xenopus tropicalis


Alignment Length:248 Identity:88/248 - (35%)
Similarity:135/248 - (54%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 SNQPKSTKMENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELVDPTPDIYAMFIRF 131
            :|...|..:||..:.....|....:.:.|.....|    ::.:::||.||.:||.||...::.:|
 Frog     5 NNPSTSNNLENPNLSTFNTEGENSQNLPADNPPAD----RSYSIIDPIWETLDPNPDPQILYNQF 65

  Fly   132 DEKFFQERLGAVSLEWSKKMYSCAGICYQRGNRFVKQV--TIRLSEPLLKLRPRKDLVETLLHEM 194
            ::..|...|..|.::||.:|....|:||...|:....:  .||||:.:|:||.|||:||:|||||
 Frog    66 NKIIFGGTLPTVDVKWSNRMTRSTGVCYHSLNKSGDCIGCRIRLSKKILELRRRKDMVESLLHEM 130

  Fly   195 IHAYCFVLNIREGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRTHIWRCTGICRERSP 259
            ||......|..:....|||||:..||..|...|||||:.|||::||.:.:.|.|.|.|.|:    
 Frog   131 IHVLLCSTNNMDPGDDHGPNFRLTMEVFNNSFGTNITISHTFYEEVEAVKRHWWECDGPCQ---- 191

  Fly   260 FWGYVKRTSNRAPGPNDQWWKMHQRECSGTFLKLSEPPKAPKPETKSRAKKST 312
              ..|||.:||||...::|::.|::.|.|:|:|.||      ||..:|.::.|
 Frog   192 --NVVKRATNRAPSSKERWFREHEQTCGGSFIKTSE------PEGPARKRRRT 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mhNP_573032.1 SprT-like 124..294 CDD:287265 67/171 (39%)
ZnF_Rad18 582..605 CDD:128973
LOC100485137XP_031750737.1 SprT-like 61..170 CDD:402053 44/108 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D395183at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.