DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and ALG14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_009626.1 Gene:ALG14 / 852362 SGDID:S000000274 Length:237 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:65/199 - (32%)
Similarity:96/199 - (48%) Gaps:26/199 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TTSSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRL-----ILANSDSTSERQFRQ 61
            ::..|...:|.|||||||.||.||            .|.||.:.|     .|..||..|.::|..
Yeast    50 SSKKPLKIFVFLGSGGHTGEMIRL------------LENYQDLLLGKSIVYLGYSDEASRQRFAH 102

  Fly    62 VLPQAAQ-RAEFVKVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDR------PQLILCNGPGTC 119
            .:.:... :.::.:..::|:|..:.|.|:.|.:..|:.|...|.|.|      |.|.|.||||||
Yeast   103 FIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTC 167

  Fly   120 VPFCYAAYLWRLLGRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNV 184
            ....:...:..||..|...|.||:|||..|:.|.||:|::|..:.|.|:|.|..|...||.:.  
Yeast   168 CIISFWLKIMELLLPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRS-- 230

  Fly   185 RYFG 188
            ::||
Yeast   231 KWFG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 64/192 (33%)
ALG14NP_009626.1 Alg14 57..236 CDD:370045 64/192 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343487
Domainoid 1 1.000 87 1.000 Domainoid score I1855
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I1555
Isobase 1 0.950 - 0 Normalized mean entropy S2002
OMA 1 1.010 - - QHG56795
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto98996
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R39
SonicParanoid 1 1.000 - - X3700
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.