DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and AT4G18230

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001328332.1 Gene:AT4G18230 / 827549 AraportID:AT4G18230 Length:233 Species:Arabidopsis thaliana


Alignment Length:197 Identity:78/197 - (39%)
Similarity:119/197 - (60%) Gaps:21/197 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSPHPTYVILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQFRQVLPQAAQ 68
            |....|.::||||||||||..|...|       :.:::.|...|.|.:|:.|.::.|......|:
plant    49 SQSFTTLIVLGSGGHTAEMLSLLSVL-------RKDRFTPRFYIAAATDNMSLQKARSFEDSLAE 106

  Fly    69 R-------AEFVKVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYAA 126
            :       ::|:::.|||:||||:::|::|::.|:|.:.:|:.|.|||:|||||||||:|.|..|
plant   107 KPAVKEASSQFMQIYRSREVGQSYVTSVWTTIVAILHALWLMIRIRPQVILCNGPGTCIPLCVIA 171

  Fly   127 YLWRLLGRLPSHSRIVFVESFCRVETLSLSGRLL--LPLADLFVVHWPALATRYLDKKNVRYFGR 189
            :|:::||  ...|.|.:|||..||:.|||||.||  |.:||.|.|.||.|..:|   ....|.|.
plant   172 FLFKVLG--IRWSSIFYVESVARVKKLSLSGLLLYKLRIADQFFVQWPQLHKKY---PRAHYVGC 231

  Fly   190 IL 191
            ::
plant   232 LM 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 77/189 (41%)
AT4G18230NP_001328332.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1740
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 130 1.000 Inparanoid score I1884
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449763at2759
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto3556
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.