DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and Alg14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006501962.1 Gene:Alg14 / 66789 MGIID:1914039 Length:222 Species:Mus musculus


Alignment Length:214 Identity:87/214 - (40%)
Similarity:119/214 - (55%) Gaps:39/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TTSSPHPT--------YVILGS-----GGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDS 53
            |...||..        .::.||     ||||.|:.||..:|        :..|.|...::|.||.
Mouse    24 TVLGPHHVTPRESLRLLIVAGSVFLFLGGHTTEILRLVGSL--------SNAYSPRHYVIAESDE 80

  Fly    54 TSERQFRQVLPQAAQRA------EFVK-----VPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDR 107
            .|.::...:  :...||      |:.|     :||||:|.||||||:||:.:::.:|..||.|.:
Mouse    81 MSAKKIHSL--EELSRAQNDSTTEYPKYHLHRIPRSREVRQSWLSSVFTTFYSMWFSFPLVLRIK 143

  Fly   108 PQLILCNGPGTCVPFCYAAYLWRLLGRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWP 172
            |.|:||||||||||.|.:|.|..:||  .....||:|||.||||||||||::|..|:|.|:|.||
Mouse   144 PDLVLCNGPGTCVPICVSALLLGILG--VKKVIIVYVESICRVETLSLSGKILRHLSDYFIVQWP 206

  Fly   173 ALATRYLDKKNVRYFGRIL 191
            .|..:|  .|:| |.|||:
Mouse   207 TLKEKY--PKSV-YLGRIV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 82/204 (40%)
Alg14XP_006501962.1 Alg14 39..221 CDD:370045 81/186 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836257
Domainoid 1 1.000 139 1.000 Domainoid score I4795
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 141 1.000 Inparanoid score I4478
Isobase 1 0.950 - 0 Normalized mean entropy S2002
OMA 1 1.010 - - QHG56795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto92020
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R39
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.