DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and Alg14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_008759687.1 Gene:Alg14 / 362031 RGDID:1312003 Length:263 Species:Rattus norvegicus


Alignment Length:257 Identity:80/257 - (31%)
Similarity:105/257 - (40%) Gaps:94/257 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HPT--------YVILGSGGHTAEMCRLTQAL----------LQQTDIEQTEKYQPIRLILANSDS 53
            ||.        .::.||||||||:.||..:|          :.::|....:|...:.|..|.:||
  Rat    29 HPVTPRQSLGLLIVAGSGGHTAEILRLVGSLSGAYSPRHYVIAESDEMSAKKIHSLELARAQNDS 93

  Fly    54 TSE---RQFRQVLPQAAQRAEFVKVPRSRDVGQSWLSSIFTSLWALLWSCYLV------------ 103
            |:|   ....:|||.          |.|...|.|       ::.|||...|||            
  Rat    94 TTEVCDHFSHRVLPS----------PNSEKPGGS-------AVLALLRVHYLVLHMVFLPTGSPN 141

  Fly   104 ---------------------------------------WRDRPQLILCNGPGTCVPFCYAAYLW 129
                                                   |......:||||||||||.|.:|.|.
  Rat   142 KARLVPLPSLPAPRGSLLLFPDPALFQNFTPWWLPGKAEWGWTAMEVLCNGPGTCVPICVSALLL 206

  Fly   130 RLLGRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL 191
            .:||  .....||:|||.||||||||||::|..|:|.|:|.||.|..:|  .|:| |.|||:
  Rat   207 GILG--IKKVIIVYVESICRVETLSLSGKILWHLSDYFIVQWPTLKEKY--PKSV-YLGRIV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 76/252 (30%)
Alg14XP_008759687.1 Glycosyltransferase_GTB_type 39..262 CDD:299143 75/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339921
Domainoid 1 1.000 142 1.000 Domainoid score I4578
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 144 1.000 Inparanoid score I4355
OMA 1 1.010 - - QHG56795
OrthoDB 1 1.010 - - D1449763at2759
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto95589
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.