DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and alg14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_593363.1 Gene:alg14 / 2541499 PomBaseID:SPAC5D6.06c Length:210 Species:Schizosaccharomyces pombe


Alignment Length:183 Identity:79/183 - (43%)
Similarity:108/183 - (59%) Gaps:19/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQFRQVLPQA--AQRAEFV 73
            |..||||||.||..|..||        .:|...:|..:|.||.|.......:|..:  :.:::..
pombe    39 VFFGSGGHTGEMLNLLNAL--------DDKLYSVRSYVAGSDDTMSVSKASLLSNSLPSVKSKIF 95

  Fly    74 KVPRSRDVGQSWLSSIFTSLWALLWSCYLV-WR--DRPQLILCNGPGTCVPFCYAAYLWRLLGRL 135
            ||||:|.|.||||::.||:.|:||.|..:: |.  ..|.:||||||||||..|...||.:.||: 
pombe    96 KVPRARYVKQSWLTTPFTAFWSLLGSISVIFWNPFGIPDVILCNGPGTCVFICLLGYLAKFLGK- 159

  Fly   136 PSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFG 188
              :.:||:||||.||::|||||::|:|..|.|:|.||.|||:|   |...|.|
pombe   160 --NVKIVYVESFARVKSLSLSGKILMPFVDRFLVQWPDLATKY---KRAEYIG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 79/183 (43%)
alg14NP_593363.1 Alg14 37..209 CDD:285823 79/183 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1298
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 135 1.000 Inparanoid score I1406
OMA 1 1.010 - - QHG56795
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto100482
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R39
SonicParanoid 1 1.000 - - X3700
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.