DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and ALG14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_659425.1 Gene:ALG14 / 199857 HGNCID:28287 Length:216 Species:Homo sapiens


Alignment Length:189 Identity:80/189 - (42%)
Similarity:111/189 - (58%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQFRQVLPQAAQRAE---- 71
            |:.||||||.|:.||..:|        :..|.|...::|::|..|..:........|.|..    
Human    41 VVAGSGGHTTEILRLLGSL--------SNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMY 97

  Fly    72 ----FVKVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYAAYLWRLL 132
                ..::||||:|.|||.|::||:|.::..|..|:.|.:|.|:||||||||||.|.:|.|..:|
Human    98 TKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGIL 162

  Fly   133 GRLPSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL 191
            |  .....||:|||.|||||||:||::|..|:|.|:|.||||..:|  .|:| |.|||:
Human   163 G--IKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKY--PKSV-YLGRIV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 78/186 (42%)
ALG14NP_659425.1 Alg14 39..215 CDD:285823 78/186 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146155
Domainoid 1 1.000 133 1.000 Domainoid score I5099
eggNOG 1 0.900 - - E1_KOG3339
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 136 1.000 Inparanoid score I4577
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56795
OrthoDB 1 1.010 - - D1449763at2759
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto88449
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R39
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.