DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and algn-14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001294287.1 Gene:algn-14 / 187398 WormBaseID:WBGene00019725 Length:244 Species:Caenorhabditis elegans


Alignment Length:188 Identity:70/188 - (37%)
Similarity:107/188 - (56%) Gaps:33/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSE------------RQFRQVL 63
            |:|||||||:||..|.:...::.| |:|       .|:|::|:.||            ...:.:.
 Worm    47 VVLGSGGHTSEMMELVKHFGEEFD-ERT-------YIIADTDTMSEDKVGNGDFQVWNANLQAIN 103

  Fly    64 PQAAQRAE---FVKVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYA 125
            .:.::..|   ..|:||||:||||:|:||.:::.|..::..|::|.||.||:.||||||:|...|
 Worm   104 HEKSRNNEKFCIEKIPRSREVGQSYLTSIGSTINATAFAVKLIYRIRPDLIVLNGPGTCIPVALA 168

  Fly   126 AYLW---RLLGRLPSHSRIVFVESFCRVETLSLSGRLL--LPLADLFVVHWPALATRY 178
            |..:   ||:..:     |::.||.|||:.|||||.:|  |.:.|..:||||.|...|
 Worm   169 AAFFDIIRLIDTV-----IIYEESICRVKKLSLSGAILYYLGMVDCLIVHWPGLKKSY 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 70/188 (37%)
algn-14NP_001294287.1 Alg14 45..227 CDD:285823 70/188 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158854
Domainoid 1 1.000 107 1.000 Domainoid score I4083
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I3496
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56795
OrthoDB 1 1.010 - - D1449763at2759
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto19416
orthoMCL 1 0.900 - - OOG6_102531
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.870

Return to query results.
Submit another query.