DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg14 and alg14

DIOPT Version :9

Sequence 1:NP_573031.1 Gene:Alg14 / 32479 FlyBaseID:FBgn0030645 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_002933844.1 Gene:alg14 / 100379745 XenbaseID:XB-GENE-983948 Length:256 Species:Xenopus tropicalis


Alignment Length:186 Identity:81/186 - (43%)
Similarity:114/186 - (61%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VILGSGGHTAEMCRLTQALLQQTDIEQTEKYQPIRLILANSDSTSERQ---FRQVLPQAAQRAEF 72
            |:.||||||.|:.||..:|        ::.|.|...:||.:|..||.:   |.........::.:
 Frog    84 VVAGSGGHTTEILRLLSSL--------SKSYSPTHYVLAETDKMSEDKIHLFENTRTSGVYKSTY 140

  Fly    73 V--KVPRSRDVGQSWLSSIFTSLWALLWSCYLVWRDRPQLILCNGPGTCVPFCYAAYLWRLLGRL 135
            .  ::||||:|.|||.||..|:|.::|:|..|..|.:|.|:||||||||||.|::|:|..:.|  
 Frog   141 SIHRIPRSREVRQSWSSSFLTTLQSMLYSFPLTARLQPDLVLCNGPGTCVPACFSAFLLGVFG-- 203

  Fly   136 PSHSRIVFVESFCRVETLSLSGRLLLPLADLFVVHWPALATRYLDKKNVRYFGRIL 191
            .....|::|||.|||||||||||||..::|.|:|.||.|.|:|  .|:: |.|||:
 Frog   204 IKKIIIIYVESICRVETLSLSGRLLYYISDYFIVQWPQLQTKY--PKSI-YLGRIV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg14NP_573031.1 Alg14 9..190 CDD:285823 79/183 (43%)
alg14XP_002933844.1 Alg14 82..255 CDD:370045 79/183 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4777
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49751
Inparanoid 1 1.050 141 1.000 Inparanoid score I4383
OMA 1 1.010 - - QHG56795
OrthoDB 1 1.010 - - D1449763at2759
OrthoFinder 1 1.000 - - FOG0005186
OrthoInspector 1 1.000 - - oto102329
Panther 1 1.100 - - LDO PTHR12154
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3700
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.