DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip128 and Tubgcp6

DIOPT Version :9

Sequence 1:NP_573030.2 Gene:Grip128 / 32478 FlyBaseID:FBgn0026433 Length:1092 Species:Drosophila melanogaster
Sequence 2:NP_001102218.2 Gene:Tubgcp6 / 362980 RGDID:1307743 Length:1763 Species:Rattus norvegicus


Alignment Length:451 Identity:94/451 - (20%)
Similarity:174/451 - (38%) Gaps:96/451 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 KRNMGMEDDLLLVEIFNKLQSCPLYQLLLEHALESGETQDLLCSVNTLSEMLTSNNEIQLPSLHD 653
            :||...||          |..|          |.|...:|.|.|....||        ::||...
  Rat  1314 RRNRDAED----------LSPC----------LPSSPQEDTLPSSPGPSE--------EVPSTEA 1350

  Fly   654 ELFTQFFAQLKVYCGADNTD-YEDEPEPDKDYEDLTVCNRQGIRNHEL---FAIFTQPLVEQRLE 714
            | ..:.:.:.:.|. ||.|. |..|..|| .||.::......:.:|.|   ||....|.|:..::
  Rat  1351 E-EARRWGKEQAYL-ADLTKLYRLEQYPD-SYESMSEPPMAHLVHHMLPRAFAFPVDPQVQSAVD 1412

  Fly   715 R---QRERLKSNPVLMANILKRLERSTCLQLKSELPEALREILRRRQWLANEYAIRAYCKETQVA 776
            .   |...|.:.||||       :||....|.:.:.            |.|:.|:..:..|..:.
  Rat  1413 ESAVQLSELLTLPVLM-------KRSLMAPLAAHVS------------LVNKAAVDYFFVELHLE 1458

  Fly   777 EKMRFLRHTMLLEKYYLFVPYYNALFVRM-------EKNNSWALGSVLTSKLCAVL---LPHYPQ 831
            .....|||.:|:|.........:.||.::       |..|...|.|:|:..|...|   .||...
  Rat  1459 THFEALRHFLLMEDGEFAQSLSDLLFEKLGAGQTPGELLNPLVLNSILSKALQYSLHGDTPHATN 1523

  Fly   832 LAHYLHVKLISQINSNSIKVYEALEAIELDFERPMAMHQWYILTPAHMQDYNSVWRLMLKVKWAV 896
            |:..|  |.:.::.:.:..  :.|..:||.::....::  .::|.:.:..|:.::..:|::|..:
  Rat  1524 LSFAL--KYLPEVFAPNAP--DVLSCLELRYKVDWPLN--IVITESCLNKYSGIFSFLLQLKLMM 1582

  Fly   897 WKLENMQF-LRRARFNPCAPLDLIGLT-----IRRLEIVRFWLIFLINNLHAHIMEAVSR----Q 951
            |.|:::.| |:|..        |:..|     .|:|::.:..:...:..:..:|...:..    :
  Rat  1583 WTLKDICFHLKRTA--------LVSHTAGSVQFRQLQLFKHEMQHFVKVIQGYIANQILHVSWCE 1639

  Fly   952 FELRIGECKNVRELRIMHDEHLAWLKTHCMLTDEFKAFRVALDQIFHLV-----YVLDMEW 1007
            |..|:....::.|::..|.|:|.......:||::.......:..||.||     .::...|
  Rat  1640 FRARLAVVGDLEEIQRAHAEYLHRAVFRGLLTEKAAPVMNIIHSIFSLVLKFRSQLISQNW 1700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grip128NP_573030.2 Spc97_Spc98 373..>580 CDD:282045
Tubgcp6NP_001102218.2 GCP_N_terminal 352..612 CDD:407574
TPH 628..>805 CDD:404709
DUF4573 1044..1199 CDD:405774
Spc97_Spc98 1460..1760 CDD:398000 49/255 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110079at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.