DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and GLTP3

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001154632.1 Gene:GLTP3 / 821680 AraportID:AT3G21260 Length:233 Species:Arabidopsis thaliana


Alignment Length:171 Identity:40/171 - (23%)
Similarity:74/171 - (43%) Gaps:14/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IVTVIESFGKLFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLNVNVDD-----FAANALLW 100
            ||.|::..|.....:..|::.||.:|.|.:.:|.:.|..|.:::........     ..:.|.||
plant    62 IVQVLDKIGPTMAVLRHDIDQNIQRLEKMWESDPLVYSNLVEILRKEAKEGSSRKPKSCSRAALW 126

  Fly   101 LKRGLQLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLLGQ 165
            |.|.:.......:.:..|  ..:.::|.:::.|..|:||:||:|..:..|:....||..:..:..
plant   127 LTRAMDFTLALLQRLVKD--MSQNMEQAIEECYNLTIKPWHGWISSAAFKVALKLVPNNNTFINV 189

  Fly   166 GVAQAE-------NIEVLTSFLPRMRAHLDSIDALLKAHNL 199
            ..|:.|       :|..|.|.|..:.:.|.||..|.:...|
plant   190 LAAKDETHQMVQDDITSLISLLIPLLSQLHSILELYEVSKL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 29/126 (23%)
GLTP3NP_001154632.1 GLTP 53..191 CDD:370081 29/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I2989
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2342
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2729
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10219
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.