DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and Cptp

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_077792.2 Gene:Cptp / 79554 MGIID:1933107 Length:216 Species:Mus musculus


Alignment Length:182 Identity:40/182 - (21%)
Similarity:75/182 - (41%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KEIVTVIESFGKLFTPVISDMNGNINKLTKAYGADVVK-YQYLEDLIVLNVN---VD-------- 91
            |.:|..:.|.|.:|:.:..|:...:..:.:...:...: |..|:.::...|:   ||        
Mouse    37 KGLVRFLNSLGAVFSFISKDVVAKLQIMERLRSSPQSEHYASLQSMVAYEVSNKLVDMDHRSHPR 101

  Fly    92 --DFAANALLWLKRGLQLICTFFENIYNDAQAKEALKQHL-QDAYERTLKPYHGFIVQSTIKIIY 153
              ......:|.|.|.|..:..|.:.:...::  :|....| .:||..||..||.:||:..:.:.:
Mouse   102 HPHSGCRTVLRLHRALHWLQLFLDGLRTSSE--DARTSTLCSEAYNATLANYHSWIVRQAVTVAF 164

  Fly   154 SWVPTRSQLLG----QGVAQAENIEVLTSFLPRMRAHLDSIDALLKAHNLDD 201
            ..:|:|...|.    :...||  :|:|...||.:....|....|...|:|.|
Mouse   165 CALPSRKVFLEAMNMESTEQA--VEMLGEALPFIEHVYDISQKLYAEHSLLD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 28/138 (20%)
CptpNP_077792.2 GLTP 30..178 CDD:285880 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.