DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and gltpb

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_021335129.1 Gene:gltpb / 568746 ZFINID:ZDB-GENE-091118-80 Length:209 Species:Danio rerio


Alignment Length:197 Identity:58/197 - (29%)
Similarity:99/197 - (50%) Gaps:16/197 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FPAIGDTADKLETQAFLDASKEIVTVIESFG-KLFTPVISDMNGNINKLTKAYGADVVKYQYLED 82
            |..:.||.: :.|:.||::...:....:..| |:|.|:.||:||||.|:...|.:|.|||:.|:.
Zfish     9 FAPLSDTKE-IATKTFLESVSHLPPFFDCLGSKVFAPIKSDINGNITKIKAVYDSDPVKYETLQQ 72

  Fly    83 LIVLNVNVDDF------AANALLWLKRGLQLICTFFENIYN---DAQAKEALKQHLQDAYERTLK 138
            ::::..:....      |..||:||||||:.|....:::.:   |......::.::..||::.||
Zfish    73 ILIIEKSSYGSEWPKVGATLALMWLKRGLRFIQILLQSLADGERDEDNPNLIRVNITKAYDQALK 137

  Fly   139 PYHGFIVQSTIKIIYSWVPTRSQLL-----GQGVAQAENIEVLTSFLPRMRAHLDSIDALLKAHN 198
            .|||:|||...|......|.||..|     .|.||:.:.:..:..||....|.:|:|..:....|
Zfish   138 RYHGWIVQKVFKAALFAAPCRSDFLKALSKDQEVAEEDCLAKVRQFLINFTATVDAIYEMYSTMN 202

  Fly   199 LD 200
            .:
Zfish   203 AE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 44/140 (31%)
gltpbXP_021335129.1 GLTP 21..167 CDD:312299 45/145 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582021
Domainoid 1 1.000 80 1.000 Domainoid score I8516
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5104
OMA 1 1.010 - - QHG59565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004269
OrthoInspector 1 1.000 - - otm25458
orthoMCL 1 0.900 - - OOG6_101874
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 1 1.000 - - X4638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.690

Return to query results.
Submit another query.