DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and Gltp

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_062795.2 Gene:Gltp / 56356 MGIID:1929253 Length:209 Species:Mus musculus


Alignment Length:183 Identity:60/183 - (32%)
Similarity:92/183 - (50%) Gaps:20/183 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ADK-LETQAFLDASKEIVTVIESFGK-LFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLNV 88
            ||: :||..||:|...:....:..|. :|||:.:|::|||.|:...|..|..|::.|::  :|.|
Mouse    14 ADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQN--ILEV 76

  Fly    89 NVDDFAAN--------ALLWLKRGLQLICTFFENIYN---DAQAKEALKQHLQDAYERTLKPYHG 142
            ....:.|.        |||||||||:.|..|.::|.:   |......::.:...|||..||.|||
Mouse    77 EKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHG 141

  Fly   143 FIVQSTIKIIYSWVPTRSQLL-----GQGVAQAENIEVLTSFLPRMRAHLDSI 190
            ::||...|......|.:|..|     ||.|.:.|.:|.:..||....|.:|:|
Mouse   142 WLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAI 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 45/142 (32%)
GltpNP_062795.2 GLTP 22..166 CDD:370081 46/145 (32%)
2 X 12 AA approximate tandem repeats 45..66 7/20 (35%)
Glycosphingolipid binding. /evidence=ECO:0000250 48..55 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838179
Domainoid 1 1.000 75 1.000 Domainoid score I9030
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5150
Isobase 1 0.950 - 0 Normalized mean entropy S5990
OMA 1 1.010 - - QHG59565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004269
OrthoInspector 1 1.000 - - otm42819
orthoMCL 1 0.900 - - OOG6_101874
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 1 1.000 - - X4638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.640

Return to query results.
Submit another query.