DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and gltp

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001016039.1 Gene:gltp / 548793 XenbaseID:XB-GENE-949224 Length:209 Species:Xenopus tropicalis


Alignment Length:205 Identity:58/205 - (28%)
Similarity:96/205 - (46%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFKALRGFPAIGDTADK-LETQAFLDASKEIVTVIESFGK-LFTPVISDMNGNINKLTKAYGADV 74
            |||.|        .||| ::|..|||:...:....:..|. :|:|:.:|:.|||:|:...|.::.
 Frog     8 QFKPL--------PADKQIDTCCFLDSVSHLPAFFDCLGSAIFSPIKADITGNISKIRSVYESNP 64

  Fly    75 VKYQYLEDLIVLNVNVDD------FAANALLWLKRGLQLICTFFENIYN---DAQAKEALKQHLQ 130
            .|::.|:.::.....:..      .|..||:||||||:.|....::|.:   |.|....:|.::.
 Frog    65 SKFKTLQMILEGEKELHGPQWPKVGATLALMWLKRGLKFIQVMLQSIADGERDDQNPNLIKVNIT 129

  Fly   131 DAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLL-----GQGVAQAENIEVLTSFLPRMRAHLDSI 190
            .|||..||.|||:.||...:......|.:...|     ||.|.:.|.||.:..||......:::|
 Frog   130 KAYEIALKKYHGWFVQKIFQTALIAAPYKDDFLKALSKGQTVKEEECIEKIRQFLVNYTTTIEAI 194

  Fly   191 DALLKAHNLD 200
            ..:....|.:
 Frog   195 YIMYNKMNAE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 39/140 (28%)
gltpNP_001016039.1 GLTP 23..166 CDD:370081 40/142 (28%)
2 X 12 AA approximate tandem repeats 45..66 6/20 (30%)
Glycosphingolipid binding. /evidence=ECO:0000250 48..55 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8792
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5090
OMA 1 1.010 - - QHG59565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004269
OrthoInspector 1 1.000 - - otm47929
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 1 1.000 - - X4638
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.