DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and GLTP

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_057517.1 Gene:GLTP / 51228 HGNCID:24867 Length:209 Species:Homo sapiens


Alignment Length:198 Identity:62/198 - (31%)
Similarity:97/198 - (48%) Gaps:20/198 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ADK-LETQAFLDASKEIVTVIESFGK-LFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLNV 88
            ||| :||..||:|...:....:..|. :|||:.:|::|||.|:...|..:..|::.|::  :|.|
Human    14 ADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQN--ILEV 76

  Fly    89 NVDDFAAN--------ALLWLKRGLQLICTFFENIYN---DAQAKEALKQHLQDAYERTLKPYHG 142
            ..:.:.|.        ||:||||||:.|..|.::|.:   |......::.:...|||..||.|||
Human    77 EKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHG 141

  Fly   143 FIVQSTIKIIYSWVPTRSQLL-----GQGVAQAENIEVLTSFLPRMRAHLDSIDALLKAHNLDDA 202
            :|||...:......|.:|..|     ||.|.:.|.:|.:..||....|.:|.|..:....|.:..
Human   142 WIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELN 206

  Fly   203 RKV 205
            .||
Human   207 YKV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 43/142 (30%)
GLTPNP_057517.1 GLTP 22..163 CDD:400867 43/142 (30%)
2 X 12 AA approximate tandem repeats 45..66 6/20 (30%)
Glycosphingolipid binding 48..55 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148092
Domainoid 1 1.000 72 1.000 Domainoid score I9327
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5182
Isobase 1 0.950 - 0 Normalized mean entropy S5990
OMA 1 1.010 - - QHG59565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004269
OrthoInspector 1 1.000 - - otm40747
orthoMCL 1 0.900 - - OOG6_101874
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 1 1.000 - - X4638
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.640

Return to query results.
Submit another query.