DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and plekha8

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001007375.1 Gene:plekha8 / 492502 ZFINID:ZDB-GENE-041114-69 Length:549 Species:Danio rerio


Alignment Length:191 Identity:56/191 - (29%)
Similarity:87/191 - (45%) Gaps:25/191 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LETQAFLDASKEIVTVIESFG-KLFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLNV---- 88
            :.||||||:...||.|::..| .:|.||..|..|||.|:.:...:|...:..|:.:::..|    
Zfish   360 IPTQAFLDSCYAIVPVLDKLGPTVFAPVKIDFVGNIKKIQQKVVSDPESFPTLQSIVLHEVKTEV 424

  Fly    89 -NVDDFAANALLWLKRGLQLICTFFENI---YNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTI 149
             .|.:.|..|||||||||:.:..|...|   ..|.|..      |.:||.:||:.|||::|:...
Zfish   425 AQVRNSATEALLWLKRGLKFLKEFLSEINTGVKDVQGA------LYNAYGKTLRQYHGWVVRGVF 483

  Fly   150 KIIYSWVPTRSQLLG-----QGVAQAENIEV-----LTSFLPRMRAHLDSIDALLKAHNLD 200
            .:.....|:....:.     :|....|....     |..:||.|...|..:|.|.:.:.|:
Zfish   484 ALALRAAPSYEGFMAALVSYEGDELKEGFRTGMHRDLDIYLPAMENQLSILDTLYEEYGLE 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 45/139 (32%)
plekha8NP_001007375.1 PH_FAPP1_FAPP2 1..100 CDD:269951
PH 1..88 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 180..312
GLTP 363..500 CDD:285880 45/142 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582024
Domainoid 1 1.000 80 1.000 Domainoid score I8516
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25458
orthoMCL 1 0.900 - - OOG6_101874
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.