powered by:
Protein Alignment CG6299 and plekha3
DIOPT Version :9
Sequence 1: | NP_001285269.1 |
Gene: | CG6299 / 32475 |
FlyBaseID: | FBgn0030641 |
Length: | 205 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_957501.1 |
Gene: | plekha3 / 394182 |
ZFINID: | ZDB-GENE-040426-1252 |
Length: | 298 |
Species: | Danio rerio |
Alignment Length: | 33 |
Identity: | 9/33 - (27%) |
Similarity: | 17/33 - (51%) |
Gaps: | 1/33 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 PAIGDTADKLETQAFLDASKE-IVTVIESFGKL 51
||:.:|..:.|..:.|.|:.| .:..:|...|:
Zfish 144 PAVANTETRNEASSLLSATCETFIKTLEECMKI 176
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170582019 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm25458 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.