DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and plekha3

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_957501.1 Gene:plekha3 / 394182 ZFINID:ZDB-GENE-040426-1252 Length:298 Species:Danio rerio


Alignment Length:33 Identity:9/33 - (27%)
Similarity:17/33 - (51%) Gaps:1/33 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAIGDTADKLETQAFLDASKE-IVTVIESFGKL 51
            ||:.:|..:.|..:.|.|:.| .:..:|...|:
Zfish   144 PAVANTETRNEASSLLSATCETFIKTLEECMKI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 5/21 (24%)
plekha3NP_957501.1 PH_FAPP1_FAPP2 1..100 CDD:269951
PH 1..93 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582019
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25458
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.