DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and cert

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001286978.1 Gene:cert / 38928 FlyBaseID:FBgn0027569 Length:601 Species:Drosophila melanogaster


Alignment Length:87 Identity:23/87 - (26%)
Similarity:37/87 - (42%) Gaps:12/87 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLLGQGVAQAENIEVLTSFLP 181
            :||..:|   ::|.::.|     ..|::.:.| ..||.|.| |..:|..|.......|..:.|  
  Fly    27 SDASEEE---EYLDNSIE-----LRGYLSKWT-NYIYGWQP-RYIVLKDGTLSYYKSESESDF-- 79

  Fly   182 RMRAHLDSIDALLKAHNLDDAR 203
            ..|..:....|.:|||..|:.|
  Fly    80 GCRGAISLTKATIKAHESDELR 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 12/45 (27%)
certNP_001286978.1 PH 40..130 CDD:278594 19/71 (27%)
PH_GPBP 42..142 CDD:270100 18/64 (28%)
START_STARD11-like 363..601 CDD:176881
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10219
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.