DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and GLTPD2

DIOPT Version :10

Sequence 1:NP_788905.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001362730.1 Gene:GLTPD2 / 388323 HGNCID:33756 Length:327 Species:Homo sapiens


Alignment Length:80 Identity:21/80 - (26%)
Similarity:33/80 - (41%) Gaps:3/80 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 ANALLWLKRGLQLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTR 159
            :..||.|.|.|:........:...|...........|||...|.|:|.::|:.|.::.:...|.|
Human   216 SRTLLLLHRALRWSQLCLHRVATGALGGPDAGVQCSDAYRAALGPHHPWLVRQTARLAFLAFPGR 280

  Fly   160 SQLLG---QGVAQAE 171
            .:||.   .|..:||
Human   281 RRLLELACPGATEAE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_788905.1 GLTP 29..163 CDD:462575 16/67 (24%)
GLTPD2NP_001362730.1 GLTP 135..285 CDD:462575 17/68 (25%)

Return to query results.
Submit another query.