DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and CG30392

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001286672.1 Gene:CG30392 / 246587 FlyBaseID:FBgn0050392 Length:223 Species:Drosophila melanogaster


Alignment Length:189 Identity:48/189 - (25%)
Similarity:82/189 - (43%) Gaps:22/189 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DKLETQAFLDASKEIVTVIESFGKLFTPVISDMNGNINKLTKAYGAD------------VVKYQY 79
            |.::..|:|.|.:||:...:..|.:|:.|.||:...|:.|......|            ::.|:.
  Fly    37 DDVQLDAYLAAYEEIMKFFQLMGSVFSFVSSDVRSKIDILYALRAKDAEEQEHFNTFRTMLDYEK 101

  Fly    80 LEDLIVLNVNVDDFAANALLWLKRGLQLICTFFENIY---NDAQAKEALKQHLQDAYERTLKPYH 141
            ...|:.....|.  .:..||.|.|||..:..|...|.   :|.:..:..|    :||:.||..:|
  Fly   102 EAQLLTQKGYVS--GSRTLLRLHRGLDFVYEFLNRIQAIPDDQKTVDVCK----EAYDDTLGKHH 160

  Fly   142 GFIVQSTIKIIYSWVPTRSQLLGQGVAQAENI-EVLTSFLPRMRAHLDSIDALLKAHNL 199
            .|:::...::....:|||..||.:..:..|.. |.|.|.|..||.:.|..:.|...::|
  Fly   161 SFLIRKGARLAMYAMPTRGDLLKKVCSDVEAAKENLPSMLKHMRTNYDRTEDLYTLYDL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 35/145 (24%)
CG30392NP_001286672.1 GLTP 42..186 CDD:285880 37/149 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10219
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.