DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and Plekha8

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001157833.1 Gene:Plekha8 / 231999 MGIID:2681164 Length:519 Species:Mus musculus


Alignment Length:188 Identity:52/188 - (27%)
Similarity:93/188 - (49%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LETQAFLDASKEIVTVIESFG-KLFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLNVNVD- 91
            :.|:|||.:...:|.|::..| .:|.||..|:.|||.|:.:.|..:..::..|:.:::..|..| 
Mouse   330 IPTEAFLASCYAVVPVLDKLGPTVFAPVKMDLVGNIKKVNQKYITNKEEFTTLQKIVLHEVEADV 394

  Fly    92 ----DFAANALLWLKRGLQLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQSTIKII 152
                :.|..|||||||||:.:..|...:.|   .::.::..|.:||.:||:.:||::|:....:.
Mouse   395 AQVRNSATEALLWLKRGLKFLKGFLTEVKN---GEKDIQTALNNAYGKTLRQHHGWVVRGVFALA 456

  Fly   153 YSWVPTRSQLLG-----QGVAQAENIEV-----LTSFLPRMRAHLDSIDALLKAHNLD 200
            ....|:....:.     :|..|.|....     |:.:||.|...|..:|.|.:.|.|:
Mouse   457 LRAAPSYEDFVAALTIKEGDHQKEAFSAGMQRDLSLYLPAMEKQLAILDTLYEIHGLE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 39/136 (29%)
Plekha8NP_001157833.1 PH_FAPP1_FAPP2 1..100 CDD:269951
PH 1..93 CDD:278594
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..302
Glycolipid transfer protein homology domain 330..473 40/145 (28%)
GLTP 333..470 CDD:285880 39/139 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838182
Domainoid 1 1.000 75 1.000 Domainoid score I9030
eggNOG 1 0.900 - - E1_KOG3221
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42819
orthoMCL 1 0.900 - - OOG6_101874
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.670

Return to query results.
Submit another query.