DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and Gltpd2

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_666132.1 Gene:Gltpd2 / 216871 MGIID:2444527 Length:321 Species:Mus musculus


Alignment Length:204 Identity:40/204 - (19%)
Similarity:69/204 - (33%) Gaps:40/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GDTADKLETQAFLDASKEIVTVIESFGKLFTPVISDMNGNINKLT----KAYGADVVKYQYLEDL 83
            ||.|    ...:|...:|::..:...|.:|....|:.   .||:|    :.:|.:...|..|..:
Mouse   127 GDVA----LSQYLAGWRELLRFLTPLGTVFAFATSEA---FNKVTDLEARVHGPNASHYTSLMTM 184

  Fly    84 IVL--------------NVNVDDFAANALLWLKRGLQLICTFFENIYNDAQAKEALKQHLQDAYE 134
            |..              ..:.....:..||.|.|.|:........:...............:||.
Mouse   185 ITWERGAGLLQRPGTEPGHSAGSSGSRTLLLLHRALRWSQLCLHRVATGTLGGPDAGTQCGEAYS 249

  Fly   135 RTLKPYHGFIVQSTIKIIYSWVPTRSQLL-----GQGVAQAENIEVLTSFLPRMRAHLDSI---- 190
            ..|.|:|.::::...::....:|:|.:||     |.|.|.|.      ..|.|....|:.:    
Mouse   250 TALAPHHPWLIRQAARLAILALPSRGRLLQLACPGTGEADAR------VALARAAGVLEDVYNRT 308

  Fly   191 DALLKAHNL 199
            ..||..|.|
Mouse   309 QGLLAGHGL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 24/148 (16%)
Gltpd2NP_666132.1 GLTP 132..282 CDD:285880 26/152 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.