DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and Y82E9BR.14

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001022958.1 Gene:Y82E9BR.14 / 175298 WormBaseID:WBGene00022347 Length:231 Species:Caenorhabditis elegans


Alignment Length:185 Identity:55/185 - (29%)
Similarity:85/185 - (45%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FPAIGDTADKLETQAFLDASKEIVTVIESFGKLFTPVISDMNGNINKLTKAYGADVVKYQYLEDL 83
            ||.:.|.. |:.|..||.|.:.|...:...|..|:.|..|:.||::|:...:..|....:||:.|
 Worm    32 FPHLTDDG-KIPTAQFLSACQGIADFVSFLGATFSLVRKDIQGNVDKVRVRFEKDQEGQKYLQQL 95

  Fly    84 IVLNVNVD--------DFAANALLWLKRGLQL---ICTFFENIYNDAQAK---EALKQHLQDAYE 134
            |    :.|        ..|...|||||||||.   :.|.....||....:   |.|...:..||.
 Worm    96 I----DADLAEHGGKFGIATEGLLWLKRGLQFMLELLTEMVTAYNSGLPRDKTEDLSGAVATAYG 156

  Fly   135 RTLKPYHGFIVQSTIKIIYSWVPTRSQLLGQGVAQAENIEVLTSFLPRMRAHLDS 189
            ::||.:||||.:...|::...||.|.|:|.......|.::.:.  :..::.|||:
 Worm   157 KSLKRHHGFIAKQAFKVVTMAVPYRRQILKAVALGQEGLDDVC--IHHIQCHLDN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 45/144 (31%)
Y82E9BR.14NP_001022958.1 GLTP 44..189 CDD:370081 46/148 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160157
Domainoid 1 1.000 67 1.000 Domainoid score I6447
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I3883
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59565
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004269
OrthoInspector 1 1.000 - - oto18966
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.