DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and plekha8

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_002932833.3 Gene:plekha8 / 100489403 XenbaseID:XB-GENE-949914 Length:547 Species:Xenopus tropicalis


Alignment Length:198 Identity:58/198 - (29%)
Similarity:97/198 - (48%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DTADKLETQAFLDASKEIVTVIESFGK-LFTPVISDMNGNINKLTKAYGADVVKYQYLEDLIVLN 87
            :..:.:.|:.|||:...||.|::..|. :|.||..|..|||.|:.:.|.....::..|:.:::..
 Frog   353 EDGEGIPTERFLDSCYAIVPVLDKLGSTVFAPVKMDFVGNIKKINQKYITSKEEFTTLQKIVLHE 417

  Fly    88 VN-----VDDFAANALLWLKRGLQLICTFFENIYNDAQAKEALKQHLQDAYERTLKPYHGFIVQS 147
            ||     |.:.|..|||||||||:.:..|...:.|   .::.::..|.:||.:||:.|||::|:.
 Frog   418 VNANVTQVRNSATEALLWLKRGLKFLYEFLSEVRN---GEKNIQTALSNAYGKTLRQYHGWVVRG 479

  Fly   148 TIKIIYSWVPTRSQLLGQGVAQAENIEV---------------LTSFLPRMRAHLDSIDALLKAH 197
            ...:.....||.     :|.|.|.:||.               |..:||.|:..|:.:|.|.:.|
 Frog   480 VFALALRAAPTY-----EGFATALSIEEGEGNKEGFFNAMKRDLNIYLPAMQKQLNILDTLYEEH 539

  Fly   198 NLD 200
            .|:
 Frog   540 GLE 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 43/136 (32%)
plekha8XP_002932833.3 PH_FAPP1_FAPP2 18..117 CDD:269951
GLTP 361..494 CDD:400867 43/140 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8792
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47929
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4235
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.