DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6299 and gltpd2a

DIOPT Version :9

Sequence 1:NP_001285269.1 Gene:CG6299 / 32475 FlyBaseID:FBgn0030641 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_001342223.1 Gene:gltpd2a / 100002437 ZFINID:ZDB-GENE-110411-68 Length:299 Species:Danio rerio


Alignment Length:174 Identity:37/174 - (21%)
Similarity:70/174 - (40%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AIGDTADKLETQAFLDASKEIVTVIESFGKL---FTPVISDMNGNINKL--------------TK 68
            |:|..:|.| ...:|...:|::..:|:.|.|   ||..:.:....|.:|              :.
Zfish    86 ALGPASDVL-LDPYLLCWEELIKFMEALGPLVGFFTHKVEEKIALIRQLSLEESTRHSVTASNSM 149

  Fly    69 AYGADVV------KYQYLEDLI--VLNVNVDDF------AANALLWLKRGLQLICTFFENIYNDA 119
            .|||...      .|..:..::  .|...|..|      .:..||.|.|.|..:....|.:..:.
Zfish   150 MYGAQHEAPPPGHAYHSVHSMLEAELQRGVVSFDQQTPSGSRTLLRLHRSLLWLQLLLEKLGTER 214

  Fly   120 QAKEALKQHLQDAYERTLKPYHGFIVQSTIKIIYSWVPTRSQLL 163
            :.: :..:..::||...|.|:|.::||...::::..:|.||..|
Zfish   215 EGR-SFGELCREAYLEVLAPHHPWLVQRAAELVFHAMPDRSVFL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6299NP_001285269.1 GLTP 32..163 CDD:285880 32/161 (20%)
gltpd2aXP_001342223.1 GLTP 96..262 CDD:285880 33/163 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.