DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and ARR3

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_015527.1 Gene:ARR3 / 856331 SGDID:S000006405 Length:404 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:47/265 - (17%)
Similarity:100/265 - (37%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 NTSELPTNWSNDSTLDVKIKRPKRVVDDIFLGTIILLM--------------SLLYISFGAALNL 174
            |.:::.|...:.|.||:.:  |..::..|.:..||.:.              :|:.:|....:.:
Yeast    19 NRTDILTTIKSLSWLDLML--PFTIILSIIIAVIISVYVPSSRHTFDAEGHPNLMGVSIPLTVGM 81

  Fly   175 DVL------------------RGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAMQLGLF 221
            .|:                  |..|.:.....: |:..|:| |||..||...........:.|:.
Yeast    82 IVMMIPPICKVSWESIHKYFYRSYIRKQLALSL-FLNWVIG-PLLMTALAWMALFDYKEYRQGII 144

  Fly   222 FTGISPSGGASNTWSAVLGGNIHLSVLMTTVSN---VAAFATIPLWTI---------TLGQLIFE 274
            ..|::........|:.:.||:..|.|::...::   :..:|.:.::..         |..:::||
Yeast   145 MIGVARCIAMVLIWNQIAGGDNDLCVVLVITNSLLQMVLYAPLQIFYCYVISHDHLNTSNRVLFE 209

  Fly   275 RAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFY- 338
            ...        .|....|.:||.:|:::     ::..:.:........:|:.||..:|:|...| 
Yeast   210 EVA--------KSVGVFLGIPLGIGIII-----RLGSLTIAGKSNYEKYILRFISPWAMIGFHYT 261

  Fly   339 LFYLF 343
            ||.:|
Yeast   262 LFVIF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 41/238 (17%)
ARR3NP_015527.1 acr3 30..391 CDD:213563 45/254 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.