DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and RCH1

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_013748.1 Gene:RCH1 / 855050 SGDID:S000004637 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:62/291 - (21%)
Similarity:111/291 - (38%) Gaps:75/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LGLFFTGISPSGGASN---TWSAVLGGNIHLSVLMTTVSN-VAAFATIPLWTITLGQLIFERA-- 276
            :||..|...|:..|||   |.:|  |||..|.|....:.| :.||.| |    .|.|:...||  
Yeast   122 IGLILTATCPTTVASNVIMTTNA--GGNSLLCVCEVFIGNLLGAFIT-P----ALVQMFTNRAPF 179

  Fly   277 ---------GIKVPYGKI-ASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLK----PVSAFIILF 327
                     ||...||:: .....|:.:||.:|.::|...|:.....:..||    .:.::::|.
Yeast   180 AYGNPATGNGIGALYGRVMKQVGLSVFVPLFVGQVIQNCFPKGTAYYLGFLKKYHIKIGSYMLLL 244

  Fly   328 IIVFAIINNFY-----------LFYLFSWQIVVAGMALPGLGYIFA---FLAAKLLHQ------- 371
            |:..:....||           :.:|..:.:.:. :...||.|:.|   |:.....|:       
Yeast   245 IMFSSFSTAFYQDAFTSVSHVCIIFLCFFNLGIY-IFFTGLSYLCARPWFILKLFPHEPIEGKST 308

  Fly   372 ---------------NAADALTIAIETGIQNTGIAIFLLTTTLESPEADI-TTVVPVSV----AV 416
                           :..||:.|......:...:.:.|:|:.....:..: ..:||:.:    .|
Yeast   309 RLYRYSYNIFRPFYYSKEDAICIMFCGPAKTAALGVSLITSQYGDKKEHLGKLLVPLVLYQVEQV 373

  Fly   417 MTPLPLLGIYLYNRCWGNKRISEASATASEA 447
            ||....:.::   :.|..|   :|.|..||:
Yeast   374 MTANFFVSLF---KRWIQK---DAQADGSES 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 53/258 (21%)
RCH1NP_013748.1 SBF_like 23..385 CDD:404480 56/273 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.