DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and AT1G78560

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_565182.1 Gene:AT1G78560 / 844192 AraportID:AT1G78560 Length:401 Species:Arabidopsis thaliana


Alignment Length:260 Identity:76/260 - (29%)
Similarity:129/260 - (49%) Gaps:13/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 ILLMSLLYISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFI-FPQAPAMQLGLF 221
            |:.:::..:..|..|.||.|||.::.|.....||::|...|||.::.:...: .|  |....||.
plant   128 IVGLTITMLGMGMTLTLDDLRGALSMPKELFAGFLLQYSVMPLSAFFVSKLLNLP--PHYAAGLI 190

  Fly   222 FTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPLWTITLG-QLIFERAGIKVPYGKI 285
            ..|..|.|.|||..:.:..||:.||||||..|.|:|....||.|..|. |.|...|     .|.:
plant   191 LVGCCPGGTASNIVTYIARGNVALSVLMTAASTVSAVIMTPLLTAKLAKQYITVDA-----LGLL 250

  Fly   286 ASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFYLFYLFSWQIVVA 350
            .|....::||:|.|..:.:...::.:.:..::.|::...:..:..:||..|.....:...|:|:|
plant   251 MSTLQVVLLPVLAGAFLNQYFKKLVKFVSPVMPPIAVGTVAILCGYAIGQNASAILMSGKQVVLA 315

  Fly   351 GMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLLTTTLESPEADITTVVPVSVA 415
            ...|...|::|.:|.:::|..:.|.:.||:||.|:||:.:.:.|.|....:|    .|.||.:|:
plant   316 SCLLHISGFLFGYLFSRILGIDVASSRTISIEVGMQNSVLGVVLATQHFGNP----LTAVPCAVS 376

  Fly   416  415
            plant   377  376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 76/260 (29%)
AT1G78560NP_565182.1 YfeH 97..400 CDD:223462 76/260 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3297
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I2107
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3433
orthoMCL 1 0.900 - - OOG6_101982
Panther 1 1.100 - - LDO PTHR10361
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.