DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and Slc10a6

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_083691.1 Gene:Slc10a6 / 75750 MGIID:1923000 Length:373 Species:Mus musculus


Alignment Length:256 Identity:74/256 - (28%)
Similarity:121/256 - (47%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LGTII--LLMSLLYISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAM 216
            |.|::  :::.|:..|||.::....|...:.||.|..:|.:.|...|||.:|.|.:. |...|..
Mouse    33 LFTVLSAVMVGLVMFSFGCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAIG-FGLKPFQ 96

  Fly   217 QLGLFFTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPL--------WTITLGQLIF 273
            .:.:...|..|.|..||..:..:.|::.||:.|||.|.|||...:||        ||:|      
Mouse    97 AIAVLMMGSCPGGTISNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYIYTRSWTLT------ 155

  Fly   274 ERAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFY 338
              ..:.:||..|.....|||:|:..|:.|..|.|:.|.|::::...:...::|.:.|..::    
Mouse   156 --QNLVIPYQSIGITLVSLVVPVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAVTGMV---- 214

  Fly   339 LFYLFSWQ----IVVAGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLL 395
              ....|.    ::|.....|.:|::..||.|.|.||:.....||:||||.||..:.|.:|
Mouse   215 --LAKGWNTDVTLLVISCIFPLVGHVTGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAML 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 74/256 (29%)
Slc10a6NP_083691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
bass 32..312 CDD:188087 74/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8733
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10361
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3973
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.910

Return to query results.
Submit another query.