DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and slc10a4

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001315270.1 Gene:slc10a4 / 556491 ZFINID:ZDB-GENE-041014-249 Length:330 Species:Danio rerio


Alignment Length:274 Identity:69/274 - (25%)
Similarity:121/274 - (44%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGV-FIFPQAPAMQLGLFFTGISPSG 229
            :..|..:.|..|...|.:|.|..:..|.|.|.|||:::.|.: |......||  .:...|..|.|
Zfish     2 LGLGCTVELSQLGEHIRKPIGVLLAAVCQFVLMPLIAFLLALAFSLNDVAAM--AVLLCGCCPGG 64

  Fly   230 GASNTWSAVLGGNIHLSVLMTTVSNVAAFATIP--LWTITLGQLIFERAGIK------VPYGKIA 286
            ..||..:.::.|:::||::||..|.:.|...:|  ||       ::.||.|.      :|:|.|.
Zfish    65 NLSNIMTLLVNGDMNLSIIMTISSTLLALVLMPLCLW-------MYSRAWINTPVVDLLPFGPII 122

  Fly   287 SYSSSLVLPLLLGLLVQKRMPQVARVLVR--LLKPVSAFIILFIIVFAIINNFYLFYLFSWQIVV 349
            ....|.::|:.||:.:::|...||.|:::  |...:...::|||:...::.. .|.......:.:
Zfish   123 LTLCSTLIPIGLGVWLRQRYIHVAEVIIKVSLWSLLVTLLMLFIMTGTMLGP-ELLATIPASVYL 186

  Fly   350 AGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNT-----------------GIAIF-LLT 396
            ..:.:|..||...:..|.|.........|:::|||.||.                 |:.:| ||.
Zfish   187 VAVLMPMAGYTAGYGLATLFDLPPNSRRTVSLETGCQNIQLCTAILKLAFPPQLMGGMYMFPLLY 251

  Fly   397 TTLESPEADITTVV 410
            ...::.||.|..:|
Zfish   252 ALFQAAEAGIFILV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 69/274 (25%)
slc10a4NP_001315270.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6548
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10361
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.