DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and slc10a2

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_956652.1 Gene:slc10a2 / 393329 ZFINID:ZDB-GENE-040426-1328 Length:361 Species:Danio rerio


Alignment Length:309 Identity:88/309 - (28%)
Similarity:144/309 - (46%) Gaps:36/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 IILLMSLLYISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAMQLGLF 221
            |.::::::..|.|..:....|.|.:.||.|..|||:.|...||..::.|.: :|...|...:.:.
Zfish    39 ITVMLAMVMFSMGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSL-LFNVLPVQAVVII 102

  Fly   222 FTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPL--------WTITLGQLIFERAG- 277
            ..|..|.|.:||.:...|.|::.||:.||..|::.|...:||        ||          || 
Zfish   103 IMGCCPGGSSSNVFCYWLDGDMDLSISMTACSSILALGMMPLCLLIYTTIWT----------AGD 157

  Fly   278 -IKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFYLFY 341
             |::||..|.....||::|:.||:||:.:.|:.|:   ::||..|...|:.|||.|:|..  :.|
Zfish   158 AIQIPYDNIGITLVSLLVPVGLGMLVKHKWPKAAK---KILKVGSVVGIVLIIVIAVIGG--VLY 217

  Fly   342 LFSWQIV----VAGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLLTTTLESP 402
            ..||.|.    :.|...|.:|:...||.|:.:.|......|||:|||:||..:|..:...:....
Zfish   218 QSSWTIAPSLWIIGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGMQNAQLASTITQLSFSPA 282

  Fly   403 EADITTVVPVSVAVMTPLPLLGI-----YLYNRCWGNKRISEASATASE 446
            |.::....|:..::. .|.:.||     |...||.....:.|.....:|
Zfish   283 ELEVMFAFPLIYSIF-QLVVAGIAVSIHYSIKRCRHQTLVEEDGEGTTE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 80/272 (29%)
slc10a2NP_956652.1 bass 30..315 CDD:188087 84/292 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6548
orthoMCL 1 0.900 - - OOG6_101982
Panther 1 1.100 - - O PTHR10361
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2568
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.