DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and Slc10a2

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_058918.1 Gene:Slc10a2 / 29500 RGDID:3682 Length:348 Species:Rattus norvegicus


Alignment Length:298 Identity:77/298 - (25%)
Similarity:142/298 - (47%) Gaps:22/298 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 VVDDIFLGTIILLMSLLYISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPL----LSYALGVF 208
            ::..:....:.:|::::..|.|..:.::...|.|.||.|..:||:.|...|||    ||.|.|:.
  Rat    29 ILSTVMSTVLTILLAMVMFSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGIL 93

  Fly   209 IFPQAPAMQLGLFFTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPLWTITLGQLIF 273
                 |...:.:...|..|.|..||..:..:.|::.|||.|||.|.:.|...:||......::..
  Rat    94 -----PVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWV 153

  Fly   274 ERAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFY 338
            :...|.:||..|.....:||:|:.:|:.|..:.||.|::::::.....|.:|:.|   |::..  
  Rat   154 DSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLI---AVVGG-- 213

  Fly   339 LFYLFSW----QIVVAGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLLTTTL 399
            :.|..:|    ::.:.|...|..||...|..|:|..|......|:|:|||:|||.:...::..:.
  Rat   214 ILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSF 278

  Fly   400 ESPEADITTVVPVSVAV---MTPLPLLGIYL-YNRCWG 433
            ...:.::....|:...|   :....:||:|: |.:|.|
  Rat   279 SPEDLNLVFTFPLIYTVFQLVFAAIILGMYVTYKKCHG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 70/272 (26%)
Slc10a2NP_058918.1 bass 29..315 CDD:188087 75/295 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44692
orthoMCL 1 0.900 - - OOG6_101982
Panther 1 1.100 - - O PTHR10361
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2568
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.