DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and Slc10a6

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_932166.1 Gene:Slc10a6 / 289459 RGDID:727800 Length:370 Species:Rattus norvegicus


Alignment Length:256 Identity:72/256 - (28%)
Similarity:117/256 - (45%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IFLGTIILLMSLLYISFGAALNLDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAM 216
            :|.....:::.|:..|||.::....|...:.||.|..:|.:.|...|||.:|.|.:. |...|..
  Rat    33 VFTVLSAVMVGLVMFSFGCSVESRKLWLHLRRPWGIAVGLLCQFGLMPLTAYLLAIG-FGLKPFQ 96

  Fly   217 QLGLFFTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPL--------WTITLGQLIF 273
            .:.:...|..|.|..||..:..:.|::.||:.|||.|.|||...:||        ||:.      
  Rat    97 AIAVLIMGSCPGGTVSNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYVYTRSWTLP------ 155

  Fly   274 ERAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFY 338
              ..:.:||..|.....|||:|:..|:.|..|.|:.|..::::...|...::|.:.|..::    
  Rat   156 --QSLTIPYQSIGITLVSLVVPVASGIYVNYRWPKQATFILKVGAAVGGMLLLVVAVTGVV---- 214

  Fly   339 LFYLFSWQI----VVAGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLL 395
              ....|.|    :|.....|.:|::..||.|.|.||:.....||:||||.||..:.|.::
  Rat   215 --LAKGWNIDVTLLVISCIFPLVGHVMGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMM 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 72/256 (28%)
Slc10a6NP_932166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
bass 34..312 CDD:188087 72/255 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1148347at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44692
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10361
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.