powered by:
Protein Alignment CG11655 and YDR182W-A
DIOPT Version :9
Sequence 1: | NP_573024.1 |
Gene: | CG11655 / 32472 |
FlyBaseID: | FBgn0030638 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_878063.3 |
Gene: | YDR182W-A / 1466434 |
SGDID: | S000028539 |
Length: | 67 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 55 |
Identity: | 14/55 - (25%) |
Similarity: | 22/55 - (40%) |
Gaps: | 6/55 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 244 HLSVLMTTVSNVAAFATIPLWTITLGQLIFERAGIKVPYGKIASYSSSLVLPLLL 298
|.:|.:|:......| .:...|..||. ..|...||....:...|::||:|
Yeast 16 HQTVCITSTGFALCF-VVQAKTAGLGV-----TPITSLYGDKKEHLGKLLVPLVL 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11655 | NP_573024.1 |
SBF |
151..416 |
CDD:302790 |
14/55 (25%) |
YDR182W-A | NP_878063.3 |
SBF |
<27..67 |
CDD:418547 |
11/44 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0385 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.