DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11655 and YDR182W-A

DIOPT Version :9

Sequence 1:NP_573024.1 Gene:CG11655 / 32472 FlyBaseID:FBgn0030638 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_878063.3 Gene:YDR182W-A / 1466434 SGDID:S000028539 Length:67 Species:Saccharomyces cerevisiae


Alignment Length:55 Identity:14/55 - (25%)
Similarity:22/55 - (40%) Gaps:6/55 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 HLSVLMTTVSNVAAFATIPLWTITLGQLIFERAGIKVPYGKIASYSSSLVLPLLL 298
            |.:|.:|:......| .:...|..||.     ..|...||....:...|::||:|
Yeast    16 HQTVCITSTGFALCF-VVQAKTAGLGV-----TPITSLYGDKKEHLGKLLVPLVL 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11655NP_573024.1 SBF 151..416 CDD:302790 14/55 (25%)
YDR182W-ANP_878063.3 SBF <27..67 CDD:418547 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.