DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scamp and SCAMP5

DIOPT Version :9

Sequence 1:NP_001259572.1 Gene:Scamp / 32470 FlyBaseID:FBgn0040285 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_174485.1 Gene:SCAMP5 / 840097 AraportID:AT1G32050 Length:264 Species:Arabidopsis thaliana


Alignment Length:278 Identity:77/278 - (27%)
Similarity:125/278 - (44%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DYNPFEEQAKPQLQINSTNTAAVVQPLSQ--------NIPPPQTSSLGASA--PSTSIQITSEEL 96
            |.|||:|..:            :|.|.|:        :.|.....||.|:.  |..::..:|:: 
plant     6 DPNPFDEDEE------------IVNPFSKGGGRVPAASRPVEYGQSLDATVDIPLDNMNDSSQK- 57

  Fly    97 QRR----QEELDRKAAELDRREQQLQGNVPQLN--NWPPLPDNFCVKPCFYQDFEVEIPPEFQKL 155
            ||:    :.||.:|..::.|||:.:.....|::  ||||.      .|..:.|...|||...|||
plant    58 QRKLADWEAELRKKEMDIKRREEAIAKFGVQIDDKNWPPF------FPIIHHDIAKEIPVHAQKL 116

  Fly   156 VKRLYYIWIFYTMTLLANVIGGLILLFHAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDS 220
            ....:..|:...:.|:.|||..::.....|..:.||||..|.::..|.|||.|:||.|:|.|.||
plant   117 QYLAFASWLGIVLCLVFNVIATMVCWIKGGGVKIFFLATIYALIGCPLSYVLWYRPLYRAMRTDS 181

  Fly   221 SFNFMVFFFIYFFQTLYSIVQAVG----FNKMGYCGFITAIGQFDGQASGIIVGILLLNVAFCFT 281
            :..|..|||.|.....:.||.|:.    |:.....|.:.||   |..:..::.||........|.
plant   182 ALKFGWFFFTYLIHIGFCIVAAIAPPIFFHGKSLTGVLAAI---DVISDSLLAGIFYFIGFGLFC 243

  Fly   282 AVAVANVLMITKIHSIYR 299
            ..::.::.::.||:..:|
plant   244 LESLLSLWVLQKIYLYFR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScampNP_001259572.1 SCAMP 125..301 CDD:282056 54/181 (30%)
SCAMP5NP_174485.1 LTV 4..>91 CDD:282087 23/97 (24%)
SCAMP 92..263 CDD:282056 54/179 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2738
eggNOG 1 0.900 - - E1_KOG3088
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2119
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D995882at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2830
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10687
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X309
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.930

Return to query results.
Submit another query.